Lineage for d1aw1a_ (1aw1 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305037Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 305038Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 305039Protein Triosephosphate isomerase [51353] (15 species)
  7. 305167Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries)
  8. 305168Domain d1aw1a_: 1aw1 A: [28515]

Details for d1aw1a_

PDB Entry: 1aw1 (more details), 2.7 Å

PDB Description: triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate

SCOP Domain Sequences for d1aw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus}
rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
ksfaaiakaaaeaka

SCOP Domain Coordinates for d1aw1a_:

Click to download the PDB-style file with coordinates for d1aw1a_.
(The format of our PDB-style files is described here.)

Timeline for d1aw1a_: