SCOP 1.71: Domain d1btmb_: 1btm B:

Lineage for d1btmb_ (1btm B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (17 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries)

8. Domain d1btmb_: 1btm B: [28514]
   complexed with pga

Details for d1btmb_

PDB Entry: 1btm, 2.8 Å

PDB Description: triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid

SCOP Domain Sequences for d1btmb_:

Sequence; same for both SEQRES and ATOM records:

>d1btmb_ c.1.1.1 (B:) Triosephosphate isomerase {Bacillus stearothermophilus}
rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
sflqlveagrh

Timeline for d1btmb_:

• d1btmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1btmb_ appears in SCOP 1.69
  
• d1btmb_ appears in SCOP 1.73
  
• d1btmb_ appears in the current release, SCOPe 2.08