Lineage for d1btmb_ (1btm B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries) 
Domain d1btmb_: 1btm B: [28514]
Details for d1btmb_
PDB Entry: 1btm (more details), 2.8 Å
PDB Description: triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid
SCOP Domain Sequences for d1btmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btmb_ c.1.1.1 (B:) Triosephosphate isomerase {Bacillus stearothermophilus}
rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
sflqlveagrh
SCOP Domain Coordinates for d1btmb_:
Click to download the PDB-style file with coordinates for d1btmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btmb_:
- d1btmb_ first appeared (with stable ids) in SCOP 1.55
- d1btmb_ appears in SCOP 1.57
- d1btmb_ appears in SCOP 1.61
- d1btmb_ appears in the current release, SCOPe 2.08
View in 3D
