Lineage for d1btmb_ (1btm B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18354Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 18355Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 18356Protein Triosephosphate isomerase [51353] (12 species)
  7. 18357Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries)
  8. 18361Domain d1btmb_: 1btm B: [28514]

Details for d1btmb_

PDB Entry: 1btm (more details), 2.8 Å

PDB Description: triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid

SCOP Domain Sequences for d1btmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btmb_ c.1.1.1 (B:) Triosephosphate isomerase {Bacillus stearothermophilus}
rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
sflqlveagrh

SCOP Domain Coordinates for d1btmb_:

Click to download the PDB-style file with coordinates for d1btmb_.
(The format of our PDB-style files is described here.)

Timeline for d1btmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1btma_