Lineage for d1btma_ (1btm A:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (16 species) 
Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries) 
Domain d1btma_: 1btm A: [28513]
Details for d1btma_
PDB Entry: 1btm (more details), 2.8 Å
PDB Description: triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid
SCOP Domain Sequences for d1btma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus}
rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
sflqlveagrh
SCOP Domain Coordinates for d1btma_:
Click to download the PDB-style file with coordinates for d1btma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btma_:
- d1btma_ first appeared (with stable ids) in SCOP 1.55
- d1btma_ appears in SCOP 1.65
- d1btma_ appears in SCOP 1.69
- d1btma_ appears in the current release, SCOPe 2.08
View in 3D
