Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) |
Protein Triosephosphate isomerase [51353] (13 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries) |
Domain d1btma_: 1btm A: [28513] |
PDB Entry: 1btm (more details), 2.8 Å
SCOP Domain Sequences for d1btma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus} rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa sflqlveagrh
Timeline for d1btma_: