SCOP 1.57: Domain d1btma_: 1btm A:

Lineage for d1btma_ (1btm A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (13 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries)

8. Domain d1btma_: 1btm A: [28513]

Details for d1btma_

PDB Entry: 1btm, 2.8 Å

PDB Description: triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid

SCOP Domain Sequences for d1btma_:

Sequence; same for both SEQRES and ATOM records:

>d1btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus}
rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
sflqlveagrh

Timeline for d1btma_:

• d1btma_ first appeared (with stable ids) in SCOP 1.55
  
• d1btma_ appears in SCOP 1.59
  
• d1btma_ appears in the current release, SCOPe 2.08