SCOPe 2.07: Domain d2btma_: 2btm A:

Lineage for d2btma_ (2btm A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (21 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries)

8. Domain d2btma_: 2btm A: [28511]
   complexed with pga

Details for d2btma_

PDB Entry: 2btm, 2.4 Å

PDB Description: does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures?

PDB Compounds: (A:) protein (triosephosphate isomerase)

SCOPe Domain Sequences for d2btma_:

Sequence; same for both SEQRES and ATOM records:

>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]}
rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
sflqlveagrh

Timeline for d2btma_:

• d2btma_ first appeared (with stable ids) in SCOP 1.55
  
• d2btma_ appears in SCOPe 2.06
  
• d2btma_ appears in the current release, SCOPe 2.08