Lineage for d2btma_ (2btm A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 64294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 64295Protein Triosephosphate isomerase [51353] (13 species)
  7. 64305Species Bacillus stearothermophilus [TaxId:1422] [51363] (2 PDB entries)
  8. 64306Domain d2btma_: 2btm A: [28511]

Details for d2btma_

PDB Entry: 2btm (more details), 2.4 Å

PDB Description: does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures?

SCOP Domain Sequences for d2btma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus}
rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
sflqlveagrh

SCOP Domain Coordinates for d2btma_:

Click to download the PDB-style file with coordinates for d2btma_.
(The format of our PDB-style files is described here.)

Timeline for d2btma_: