Lineage for d1tmhc_ (1tmh C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826028Protein Triosephosphate isomerase [51353] (21 species)
  7. 2826261Species Synthetic, hybrid between Escherichia coli and chicken TIM [51362] (1 PDB entry)
  8. 2826264Domain d1tmhc_: 1tmh C: [28509]
    complexed with so4

Details for d1tmhc_

PDB Entry: 1tmh (more details), 2.8 Å

PDB Description: modular mutagenesis of a tim-barrel enzyme: the crystal structure of a chimeric e. coli tim having the eighth (beta-alpha)-unit replaced by the equivalent unit of chicken tim
PDB Compounds: (C:) triosephosphate isomerase

SCOPe Domain Sequences for d1tmhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmhc_ c.1.1.1 (C:) Triosephosphate isomerase {Synthetic, hybrid between Escherichia coli and chicken TIM}
mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqhdvdgflvggaslkpe
fvdiinaaeaakqa

SCOPe Domain Coordinates for d1tmhc_:

Click to download the PDB-style file with coordinates for d1tmhc_.
(The format of our PDB-style files is described here.)

Timeline for d1tmhc_: