SCOP 1.67: Domain d1tmhb_: 1tmh B:

Lineage for d1tmhb_ (1tmh B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (16 species)

7. Species Hybrid between Escherichia coli and chicken TIM [51362] (1 PDB entry)

8. Domain d1tmhb_: 1tmh B: [28508]

Details for d1tmhb_

PDB Entry: 1tmh, 2.8 Å

PDB Description: modular mutagenesis of a tim-barrel enzyme: the crystal structure of a chimeric e. coli tim having the eighth (beta-alpha)-unit replaced by the equivalent unit of chicken tim

SCOP Domain Sequences for d1tmhb_:

Sequence; same for both SEQRES and ATOM records:

>d1tmhb_ c.1.1.1 (B:) Triosephosphate isomerase {Hybrid between Escherichia coli and chicken TIM}
mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqhdvdgflvggaslkpe
fvdiinaaeaakqa

Timeline for d1tmhb_:

• d1tmhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tmhb_ appears in SCOP 1.65
  
• d1tmhb_ appears in SCOP 1.69
  
• d1tmhb_ appears in the current release, SCOPe 2.08