Lineage for d1trea_ (1tre A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18354Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 18355Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 18356Protein Triosephosphate isomerase [51353] (12 species)
  7. 18388Species Escherichia coli [TaxId:562] [51361] (1 PDB entry)
  8. 18389Domain d1trea_: 1tre A: [28505]

Details for d1trea_

PDB Entry: 1tre (more details), 2.6 Å

PDB Description: the structure of triosephosphate isomerase from escherichia coli determined at 2.6 angstrom resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1trea_:

Sequence, based on SEQRES records: (download)

>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli}
mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
lgaqnvnlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
afavivkaaeaakqa

Sequence, based on observed residues (ATOM records): (download)

>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli}
mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
lgaqnvnlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
afavivkaaeaaka

SCOP Domain Coordinates for d1trea_:

Click to download the PDB-style file with coordinates for d1trea_.
(The format of our PDB-style files is described here.)

Timeline for d1trea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1treb_