Lineage for d1trea_ (1tre A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
automatically mapped to Pfam PF00121Protein Triosephosphate isomerase [51353] (21 species) 
Species Escherichia coli [TaxId:562] [51361] (1 PDB entry) 
Domain d1trea_: 1tre A: [28505]
Details for d1trea_
PDB Entry: 1tre (more details), 2.6 Å
PDB Description: the structure of triosephosphate isomerase from escherichia coli determined at 2.6 angstrom resolution
PDB Compounds: (A:) triosephosphate isomeraseSCOPe Domain Sequences for d1trea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]}
mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
lgaqnvnlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
afavivkaaeaakqa
SCOPe Domain Coordinates for d1trea_:
Click to download the PDB-style file with coordinates for d1trea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trea_:
- d1trea_ first appeared (with stable ids) in SCOP 1.55
- d1trea_ appears in SCOPe 2.07
View in 3D
