Lineage for d1amk__ (1amk -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 64294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 64295Protein Triosephosphate isomerase [51353] (13 species)
  7. 64349Species Leishmania mexicana [TaxId:5665] [51360] (3 PDB entries)
  8. 64350Domain d1amk__: 1amk - [28503]

Details for d1amk__

PDB Entry: 1amk (more details), 1.83 Å

PDB Description: leishmania mexicana triose phosphate isomerase

SCOP Domain Sequences for d1amk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amk__ c.1.1.1 (-) Triosephosphate isomerase {Leishmania mexicana}
sakpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpky
visaenaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqg
fmviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatp
eqaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkp
efrdiidatr

SCOP Domain Coordinates for d1amk__:

Click to download the PDB-style file with coordinates for d1amk__.
(The format of our PDB-style files is described here.)

Timeline for d1amk__: