Lineage for d1ydvb_ (1ydv B:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (16 species) 
Species Plasmodium falciparum [51359] (6 PDB entries) 
Domain d1ydvb_: 1ydv B: [28502]
Details for d1ydvb_
PDB Entry: 1ydv (more details), 2.2 Å
PDB Description: triosephosphate isomerase (tim)
SCOP Domain Sequences for d1ydvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydvb_ c.1.1.1 (B:) Triosephosphate isomerase {Plasmodium falciparum}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam
SCOP Domain Coordinates for d1ydvb_:
Click to download the PDB-style file with coordinates for d1ydvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ydvb_:
- d1ydvb_ first appeared (with stable ids) in SCOP 1.55
- d1ydvb_ appears in SCOP 1.65
- d1ydvb_ appears in SCOP 1.69
- d1ydvb_ appears in the current release, SCOPe 2.08
View in 3D
