Lineage for d1ydvb_ (1ydv B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18354Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 18355Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 18356Protein Triosephosphate isomerase [51353] (12 species)
  7. 18402Species Plasmodium falciparum [51359] (1 PDB entry)
  8. 18404Domain d1ydvb_: 1ydv B: [28502]

Details for d1ydvb_

PDB Entry: 1ydv (more details), 2.2 Å

PDB Description: triosephosphate isomerase (tim)
PDB Compounds: (B:)

SCOP Domain Sequences for d1ydvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydvb_ c.1.1.1 (B:) Triosephosphate isomerase {Plasmodium falciparum}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOP Domain Coordinates for d1ydvb_:

Click to download the PDB-style file with coordinates for d1ydvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ydvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ydva_