Lineage for d1ci1b_ (1ci1 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968087Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 968088Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 968089Protein Triosephosphate isomerase [51353] (20 species)
  7. 968260Species Trypanosoma cruzi [TaxId:5693] [51358] (5 PDB entries)
    Uniprot P52270
  8. 968266Domain d1ci1b_: 1ci1 B: [28500]
    structure in hexane
    complexed with hex

Details for d1ci1b_

PDB Entry: 1ci1 (more details), 2 Å

PDB Description: crystal structure of triosephosphate isomerase from trypanosoma cruzi in hexane
PDB Compounds: (B:) protein (triosephosphate isomerase)

SCOPe Domain Sequences for d1ci1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci1b_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma cruzi [TaxId: 5693]}
skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagf
hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
fveiieatk

SCOPe Domain Coordinates for d1ci1b_:

Click to download the PDB-style file with coordinates for d1ci1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ci1b_: