Lineage for d1ci1b_ (1ci1 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 64294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 64295Protein Triosephosphate isomerase [51353] (13 species)
  7. 64396Species Trypanosoma cruzi [TaxId:5693] [51358] (2 PDB entries)
  8. 64400Domain d1ci1b_: 1ci1 B: [28500]

Details for d1ci1b_

PDB Entry: 1ci1 (more details), 2 Å

PDB Description: crystal structure of triosephosphate isomerase from trypanosoma cruzi in hexane

SCOP Domain Sequences for d1ci1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci1b_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma cruzi}
skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagf
hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
fveiieatk

SCOP Domain Coordinates for d1ci1b_:

Click to download the PDB-style file with coordinates for d1ci1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ci1b_: