Lineage for d1tcdb_ (1tcd B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
automatically mapped to Pfam PF00121Protein Triosephosphate isomerase [51353] (21 species) 
Species Trypanosoma cruzi [TaxId:5693] [51358] (5 PDB entries)
Uniprot P52270
Domain d1tcdb_: 1tcd B: [28498]
Details for d1tcdb_
PDB Entry: 1tcd (more details), 1.83 Å
PDB Description: trypanosoma cruzi triosephosphate isomerase
PDB Compounds: (B:) triosephosphate isomeraseSCOPe Domain Sequences for d1tcdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcdb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma cruzi [TaxId: 5693]}
skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagf
hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
fveiieatk
SCOPe Domain Coordinates for d1tcdb_:
Click to download the PDB-style file with coordinates for d1tcdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tcdb_:
- d1tcdb_ first appeared (with stable ids) in SCOP 1.55
- d1tcdb_ appears in SCOPe 2.07
View in 3D
