Lineage for d1tcda_ (1tcd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2434697Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2434698Protein Triosephosphate isomerase [51353] (21 species)
  7. 2434946Species Trypanosoma cruzi [TaxId:5693] [51358] (5 PDB entries)
    Uniprot P52270
  8. 2434947Domain d1tcda_: 1tcd A: [28497]

Details for d1tcda_

PDB Entry: 1tcd (more details), 1.83 Å

PDB Description: trypanosoma cruzi triosephosphate isomerase
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d1tcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcda_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma cruzi [TaxId: 5693]}
kpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfqi
aaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagfh
vivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpqq
aqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpef
veiieatk

SCOPe Domain Coordinates for d1tcda_:

Click to download the PDB-style file with coordinates for d1tcda_.
(The format of our PDB-style files is described here.)

Timeline for d1tcda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tcdb_