SCOPe 2.04: Domain d6tima_: 6tim A:

Lineage for d6tima_ (6tim A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)

8. Domain d6tima_: 6tim A: [28495]
   complexed with g3p

Details for d6tima_

PDB Entry: 6tim, 2.2 Å

PDB Description: the adaptability of the active site of trypanosomal triosephosphate isomerase as observed in the crystal structures of three different complexes

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d6tima_:

Sequence; same for both SEQRES and ATOM records:

>d6tima_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d6tima_:

• d6tima_ first appeared (with stable ids) in SCOP 1.55
  
• d6tima_ appears in SCOPe 2.03
  
• d6tima_ appears in SCOPe 2.05
  
• d6tima_ appears in the current release, SCOPe 2.08