Lineage for d1ml1g_ (1ml1 G:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries) 
Domain d1ml1g_: 1ml1 G: [28492]
Details for d1ml1g_
PDB Entry: 1ml1 (more details), 2.6 Å
PDB Description: protein engineering with monomeric triosephosphate isomerase: the modelling and structure verification of a seven residue loop
SCOP Domain Sequences for d1ml1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml1g_ c.1.1.1 (G:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
q
SCOP Domain Coordinates for d1ml1g_:
Click to download the PDB-style file with coordinates for d1ml1g_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ml1g_:
- d1ml1g_ first appeared (with stable ids) in SCOP 1.55
- d1ml1g_ appears in SCOP 1.59
- d1ml1g_ appears in SCOP 1.63
- d1ml1g_ appears in the current release, SCOPe 2.08
View in 3D
