Lineage for d1ml1g_ (1ml1 G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078788Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 2078871Domain d1ml1g_: 1ml1 G: [28492]
    complexed with pga

Details for d1ml1g_

PDB Entry: 1ml1 (more details), 2.6 Å

PDB Description: protein engineering with monomeric triosephosphate isomerase: the modelling and structure verification of a seven residue loop
PDB Compounds: (G:) triosephosphate isomerase

SCOPe Domain Sequences for d1ml1g_:

Sequence, based on SEQRES records: (download)

>d1ml1g_ c.1.1.1 (G:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcsgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacig
etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
tq

Sequence, based on observed residues (ATOM records): (download)

>d1ml1g_ c.1.1.1 (G:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
q

SCOPe Domain Coordinates for d1ml1g_:

Click to download the PDB-style file with coordinates for d1ml1g_.
(The format of our PDB-style files is described here.)

Timeline for d1ml1g_: