Lineage for d1ml1e_ (1ml1 E:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 64294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 64295Protein Triosephosphate isomerase [51353] (13 species)
  7. 64359Species Trypanosoma brucei [TaxId:5691] [51357] (18 PDB entries)
  8. 64387Domain d1ml1e_: 1ml1 E: [28491]

Details for d1ml1e_

PDB Entry: 1ml1 (more details), 2.6 Å

PDB Description: protein engineering with monomeric triosephosphate isomerase: the modelling and structure verification of a seven residue loop

SCOP Domain Sequences for d1ml1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml1e_ c.1.1.1 (E:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
q

SCOP Domain Coordinates for d1ml1e_:

Click to download the PDB-style file with coordinates for d1ml1e_.
(The format of our PDB-style files is described here.)

Timeline for d1ml1e_: