Lineage for d1ml1c_ (1ml1 C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570218Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 570219Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 570220Protein Triosephosphate isomerase [51353] (17 species)
  7. 570354Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries)
  8. 570382Domain d1ml1c_: 1ml1 C: [28490]

Details for d1ml1c_

PDB Entry: 1ml1 (more details), 2.6 Å

PDB Description: protein engineering with monomeric triosephosphate isomerase: the modelling and structure verification of a seven residue loop

SCOP Domain Sequences for d1ml1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml1c_ c.1.1.1 (C:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
q

SCOP Domain Coordinates for d1ml1c_:

Click to download the PDB-style file with coordinates for d1ml1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ml1c_: