SCOP 1.75: Domain d1tsib_: 1tsi B:

Lineage for d1tsib_ (1tsi B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (18 species)

7. Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries)

8. Domain d1tsib_: 1tsi B: [28486]
   complexed with 4pb

Details for d1tsib_

PDB Entry: 1tsi, 2.84 Å

PDB Description: structure of the complex between trypanosomal triosephosphate isomerase and n-hydroxy-4-phosphono-butanamide: binding at the active site despite an "open" flexible loop

PDB Compounds: (B:) triosephosphate isomerase

SCOP Domain Sequences for d1tsib_:

Sequence; same for both SEQRES and ATOM records:

>d1tsib_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d1tsib_:

• d1tsib_ first appeared (with stable ids) in SCOP 1.55
  
• d1tsib_ appears in SCOP 1.73
  
• d1tsib_ appears in SCOPe 2.01
  
• d1tsib_ appears in the current release, SCOPe 2.08