Lineage for d1tsib_ (1tsi B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Trypanosoma brucei [TaxId:5691] [51357] (18 PDB entries) 
Domain d1tsib_: 1tsi B: [28486]
Details for d1tsib_
PDB Entry: 1tsi (more details), 2.84 Å
PDB Description: structure of the complex between trypanosomal triosephosphate isomerase and n-hydroxy-4-phosphono-butanamide: binding at the active site despite an "open" flexible loop
SCOP Domain Sequences for d1tsib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tsib_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq
SCOP Domain Coordinates for d1tsib_:
Click to download the PDB-style file with coordinates for d1tsib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tsib_:
- d1tsib_ first appeared (with stable ids) in SCOP 1.55
- d1tsib_ appears in SCOP 1.57
- d1tsib_ appears in SCOP 1.61
- d1tsib_ appears in the current release, SCOPe 2.08
View in 3D
