SCOPe 2.08: Domain d1z26a4: 1z26 A:545-770

Lineage for d1z26a4 (1z26 A:545-770)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins)
   PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1)

6. Protein Argonaute homologue PF0537 [310685] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [310902] (3 PDB entries)

8. Domain d1z26a4: 1z26 A:545-770 [284853]
   Other proteins in same PDB: d1z26a1, d1z26a3, d1z26a5
   complexed with wo4

Details for d1z26a4

PDB Entry: 1z26, 2.5 Å

PDB Description: structure of pyrococcus furiosus argonaute with bound tungstate

PDB Compounds: (A:) Argonaute

SCOPe Domain Sequences for d1z26a4:

Sequence, based on SEQRES records:

>d1z26a4 c.55.3.15 (A:545-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
ldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvdmneff
kemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknhpvraf
anmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvldifilt
rlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv

Sequence, based on observed residues (ATOM records):

>d1z26a4 c.55.3.15 (A:545-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
ldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvdmneff
kemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknhpvraf
anmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvldifilt
rlnygsirlpapvhyahkfanairnewkikeeflaegflyfv

Timeline for d1z26a4:

• d1z26a4 first appeared in SCOPe 2.06
  
• d1z26a4 appears in SCOPe 2.07