Lineage for d1z26a3 (1z26 A:324-544)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)
  6. Protein Argonaute homologue PF0537 [310686] (1 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [310903] (3 PDB entries)
  8. Domain d1z26a3: 1z26 A:324-544 [284852]
    Other proteins in same PDB: d1z26a1, d1z26a4, d1z26a5
    complexed with wo4

Details for d1z26a3

PDB Entry: 1z26 (more details), 2.5 Å

PDB Description: structure of pyrococcus furiosus argonaute with bound tungstate
PDB Compounds: (A:) Argonaute

SCOPe Domain Sequences for d1z26a3:

Sequence, based on SEQRES records: (download)

>d1z26a3 c.44.3.1 (A:324-544) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
iaqelenkirvrddkgnsvpisqlnvqksqlllwtnysrkypvilpyevpekfrkireip
mfiildsglladiqnfatnefrelvksmyyslakkynslakkarstneiglpfldfrgke
kvitedlnsdkgiievveqvssfmkgkelglafiaarnklssekfeeikrrlfnlnvisq
vvnedtlknkrdkydrnrldlfvrhnllfqvlsklgvkyyv

Sequence, based on observed residues (ATOM records): (download)

>d1z26a3 c.44.3.1 (A:324-544) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
iaqelenkirvrddkgnsvpisqllwtnysrkypvilpyevpekfrkireipmfiildsg
lladiqnfatnefrelvksmyyslakkykekvitedlnsdkgiievveqvssfmkgkelg
lafiaarnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfq
vlsklgvkyyv

SCOPe Domain Coordinates for d1z26a3 are not available.

Timeline for d1z26a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z26a1, d1z26a4, d1z26a5