Lineage for d1z25a4 (1z25 A:545-770)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887170Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1)
  6. 2887179Protein Argonaute homologue PF0537 [310685] (1 species)
  7. 2887180Species Pyrococcus furiosus [TaxId:2261] [310902] (3 PDB entries)
  8. 2887182Domain d1z25a4: 1z25 A:545-770 [284850]
    Other proteins in same PDB: d1z25a1, d1z25a3, d1z25a5
    complexed with mn

Details for d1z25a4

PDB Entry: 1z25 (more details), 2.7 Å

PDB Description: structure of p.furiosus argonaute with bound mn2+
PDB Compounds: (A:) Argonaute

SCOPe Domain Sequences for d1z25a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z25a4 c.55.3.15 (A:545-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
ldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvdmneff
kemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknhpvraf
anmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvldifilt
rlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv

SCOPe Domain Coordinates for d1z25a4:

Click to download the PDB-style file with coordinates for d1z25a4.
(The format of our PDB-style files is described here.)

Timeline for d1z25a4: