Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins) PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1) |
Protein Argonaute homologue PF0537 [310685] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [310902] (3 PDB entries) |
Domain d1z25a4: 1z25 A:545-770 [284850] Other proteins in same PDB: d1z25a1, d1z25a3, d1z25a5 complexed with mn |
PDB Entry: 1z25 (more details), 2.7 Å
SCOPe Domain Sequences for d1z25a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z25a4 c.55.3.15 (A:545-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]} ldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvdmneff kemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknhpvraf anmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvldifilt rlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv
Timeline for d1z25a4: