Lineage for d3timb_ (3tim B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1815295Protein Triosephosphate isomerase [51353] (20 species)
  7. 1815516Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 1815591Domain d3timb_: 3tim B: [28484]

Details for d3timb_

PDB Entry: 3tim (more details), 2.8 Å

PDB Description: the crystal structure of the "open" and the "closed" conformation of the flexible loop of trypanosomal triosephosphate isomerase
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3timb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3timb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOPe Domain Coordinates for d3timb_:

Click to download the PDB-style file with coordinates for d3timb_.
(The format of our PDB-style files is described here.)

Timeline for d3timb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3tima_