Lineage for d3timb_ (3tim B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries) 
Domain d3timb_: 3tim B: [28484]
Details for d3timb_
PDB Entry: 3tim (more details), 2.8 Å
PDB Description: the crystal structure of the "open" and the "closed" conformation of the flexible loop of trypanosomal triosephosphate isomerase
SCOP Domain Sequences for d3timb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3timb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq
SCOP Domain Coordinates for d3timb_:
Click to download the PDB-style file with coordinates for d3timb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3timb_:
- d3timb_ first appeared (with stable ids) in SCOP 1.55
- d3timb_ appears in SCOP 1.59
- d3timb_ appears in SCOP 1.63
- d3timb_ appears in the current release, SCOPe 2.08
View in 3D
