Lineage for d1ttia_ (1tti A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078788Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 2078861Domain d1ttia_: 1tti A: [28482]
    complexed with pga; mutant

Details for d1ttia_

PDB Entry: 1tti (more details), 2.4 Å

PDB Description: three new crystal structures of point mutation variants of monotim: conformational flexibility of loop-1,loop-4 and loop-8
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d1ttia_:

Sequence, based on SEQRES records: (download)

>d1ttia_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnagnadglaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacig
etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
tq

Sequence, based on observed residues (ATOM records): (download)

>d1ttia_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfviaaqna
gnadglaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacigetlqer
esgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahalirswv
sskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikatq

SCOPe Domain Coordinates for d1ttia_:

Click to download the PDB-style file with coordinates for d1ttia_.
(The format of our PDB-style files is described here.)

Timeline for d1ttia_: