Lineage for d1yvua3 (1yvu A:315-487)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)
  6. Protein Argonaute homologue Aq_1447 [310684] (1 species)
  7. Species Aquifex aeolicus [TaxId:63363] [310901] (4 PDB entries)
  8. Domain d1yvua3: 1yvu A:315-487 [284811]
    Other proteins in same PDB: d1yvua1, d1yvua4
    complexed with ca

Details for d1yvua3

PDB Entry: 1yvu (more details), 2.9 Å

PDB Description: Crystal structure of A. aeolicus Argonaute
PDB Compounds: (A:) hypothetical protein aq_1447

SCOPe Domain Sequences for d1yvua3:

Sequence, based on SEQRES records: (download)

>d1yvua3 c.44.3.1 (A:315-487) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk
elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk
sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyk

Sequence, based on observed residues (ATOM records): (download)

>d1yvua3 c.44.3.1 (A:315-487) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvwrkeeflkelinf
lknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivflefllydfvkrellkk
mipsqvilnrtlknenlkfvllnvaeqvlaktgnipyk

SCOPe Domain Coordinates for d1yvua3 are not available.

Timeline for d1yvua3:

Domains from same chain:
(mouse over for more information)
d1yvua1, d1yvua4