Lineage for d1mssb_ (1mss B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143365Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1143366Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
  6. 1143367Protein Triosephosphate isomerase [51353] (21 species)
  7. 1143565Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 1143655Domain d1mssb_: 1mss B: [28481]
    different dimerisation mode mutant
    mutant

Details for d1mssb_

PDB Entry: 1mss (more details), 2.4 Å

PDB Description: large scale structural rearrangements of the front loops in monomerised triosephosphate isomerase, as deduced from the comparison of the structural properties of monotim and its point mutation variant monoss
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1mssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mssb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkfv
iaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
tq

SCOPe Domain Coordinates for d1mssb_:

Click to download the PDB-style file with coordinates for d1mssb_.
(The format of our PDB-style files is described here.)

Timeline for d1mssb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mssa_