SCOP 1.71: Domain d1mssb_: 1mss B:

Lineage for d1mssb_ (1mss B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (17 species)

7. Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries)

8. Domain d1mssb_: 1mss B: [28481]
   different dimerisation mode mutant

Details for d1mssb_

PDB Entry: 1mss, 2.4 Å

PDB Description: large scale structural rearrangements of the front loops in monomerised triosephosphate isomerase, as deduced from the comparison of the structural properties of monotim and its point mutation variant monoss

SCOP Domain Sequences for d1mssb_:

Sequence; same for both SEQRES and ATOM records:

>d1mssb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkfv
iaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
tq

Timeline for d1mssb_:

• d1mssb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mssb_ appears in SCOP 1.69
  
• d1mssb_ appears in SCOP 1.73
  
• d1mssb_ appears in the current release, SCOPe 2.08