Lineage for d1mssa_ (1mss A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Trypanosoma brucei [TaxId:5691] [51357] (18 PDB entries) 
Domain d1mssa_: 1mss A: [28480]
Details for d1mssa_
PDB Entry: 1mss (more details), 2.4 Å
PDB Description: large scale structural rearrangements of the front loops in monomerised triosephosphate isomerase, as deduced from the comparison of the structural properties of monotim and its point mutation variant monoss
SCOP Domain Sequences for d1mssa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mssa_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkfv
iaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
tq
SCOP Domain Coordinates for d1mssa_:
Click to download the PDB-style file with coordinates for d1mssa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mssa_:
- d1mssa_ first appeared (with stable ids) in SCOP 1.55
- d1mssa_ appears in SCOP 1.57
- d1mssa_ appears in SCOP 1.61
- d1mssa_ appears in the current release, SCOPe 2.08
View in 3D
