SCOPe 2.07: Domain d1ytub2: 1ytu B:1-170

Lineage for d1ytub2 (1ytu B:1-170)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families)

5. Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
   PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)

6. Protein Hypothetical protein AF1318 [310688] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [310905] (3 PDB entries)

8. Domain d1ytub2: 1ytu B:1-170 [284798]
   Other proteins in same PDB: d1ytua3, d1ytub3
   protein/RNA complex; complexed with mg

Details for d1ytub2

PDB Entry: 1ytu, 2.5 Å

PDB Description: Structural basis for 5'-end-specific recognition of the guide RNA strand by the A. fulgidus PIWI protein

PDB Compounds: (B:) hypothetical protein af1318

SCOPe Domain Sequences for d1ytub2:

Sequence; same for both SEQRES and ATOM records:

>d1ytub2 c.44.3.1 (B:1-170) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
mmeykivengltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfssl
inqlksqisskidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeynt
plyyklksylinsipsqfmrydilsnrnltfyvdnllvqfvsklggkpwi

Timeline for d1ytub2:

• d1ytub2 first appeared in SCOPe 2.06
  
• d1ytub2 appears in the current release, SCOPe 2.08