Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins) PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1) |
Protein Hypothetical protein AF1318 [310687] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [310904] (3 PDB entries) |
Domain d1ytua3: 1ytu A:171-427 [284797] Other proteins in same PDB: d1ytua2, d1ytub2 protein/RNA complex; complexed with mg |
PDB Entry: 1ytu (more details), 2.5 Å
SCOPe Domain Sequences for d1ytua3:
Sequence, based on SEQRES records: (download)
>d1ytua3 c.55.3.15 (A:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]} lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail hlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpylkrnglemvtpikplsvei vsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggy pinpegnrslqtnpwfl
>d1ytua3 c.55.3.15 (A:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]} lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail hlnethpfwvmgdpyegtkvklsskrylltllqpypikplsveivsdnwtseeyyhnvhe ildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggypinpegnrslqtnpwf l
Timeline for d1ytua3: