SCOPe 2.06: Domain d1ytua3: 1ytu A:171-427

Lineage for d1ytua3 (1ytu A:171-427)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins)
   PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1)

6. Protein Hypothetical protein AF1318 [310687] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [310904] (3 PDB entries)

8. Domain d1ytua3: 1ytu A:171-427 [284797]
   Other proteins in same PDB: d1ytua2, d1ytub2
   protein/RNA complex; complexed with mg

Details for d1ytua3

PDB Entry: 1ytu, 2.5 Å

PDB Description: Structural basis for 5'-end-specific recognition of the guide RNA strand by the A. fulgidus PIWI protein

PDB Compounds: (A:) hypothetical protein af1318

SCOPe Domain Sequences for d1ytua3:

Sequence, based on SEQRES records:

>d1ytua3 c.55.3.15 (A:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti
kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail
hlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpylkrnglemvtpikplsvei
vsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggy
pinpegnrslqtnpwfl

Sequence, based on observed residues (ATOM records):

>d1ytua3 c.55.3.15 (A:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti
kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail
hlnethpfwvmgdpyegtkvklsskrylltllqpypikplsveivsdnwtseeyyhnvhe
ildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggypinpegnrslqtnpwf
l

Timeline for d1ytua3:

• d1ytua3 is new in SCOPe 2.06-stable
  
• d1ytua3 appears in SCOPe 2.07
  
• d1ytua3 appears in the current release, SCOPe 2.08