SCOP 1.57: Domain d1trdb_: 1trd B:

Lineage for d1trdb_ (1trd B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (13 species)

7. Species Trypanosoma brucei [TaxId:5691] [51357] (18 PDB entries)

8. Domain d1trdb_: 1trd B: [28477]

Details for d1trdb_

PDB Entry: 1trd, 2.5 Å

PDB Description: the influence of crystal packing on crystallographic binding studies: a new crystal form of trypanosomal tim

SCOP Domain Sequences for d1trdb_:

Sequence; same for both SEQRES and ATOM records:

>d1trdb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d1trdb_:

• d1trdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1trdb_ appears in SCOP 1.59
  
• d1trdb_ appears in the current release, SCOPe 2.08