Lineage for d1trda_ (1trd A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Trypanosoma brucei [TaxId:5691] [51357] (18 PDB entries) 
Domain d1trda_: 1trd A: [28476]
Details for d1trda_
PDB Entry: 1trd (more details), 2.5 Å
PDB Description: the influence of crystal packing on crystallographic binding studies: a new crystal form of trypanosomal tim
SCOP Domain Sequences for d1trda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trda_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq
SCOP Domain Coordinates for d1trda_:
Click to download the PDB-style file with coordinates for d1trda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trda_:
- d1trda_ first appeared (with stable ids) in SCOP 1.55
- d1trda_ appears in SCOP 1.57
- d1trda_ appears in SCOP 1.61
- d1trda_ appears in the current release, SCOPe 2.08
View in 3D
