Lineage for d1ag1t_ (1ag1 T:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 115905Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 115906Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 115907Protein Triosephosphate isomerase [51353] (13 species)
  7. 115971Species Trypanosoma brucei [TaxId:5691] [51357] (18 PDB entries)
  8. 115982Domain d1ag1t_: 1ag1 T: [28475]

Details for d1ag1t_

PDB Entry: 1ag1 (more details), 2.36 Å

PDB Description: monohydrogen phosphate binding to trypanosomal triosephosphate isomerase

SCOP Domain Sequences for d1ag1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag1t_ c.1.1.1 (T:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOP Domain Coordinates for d1ag1t_:

Click to download the PDB-style file with coordinates for d1ag1t_.
(The format of our PDB-style files is described here.)

Timeline for d1ag1t_: