Lineage for d1ag1t_ (1ag1 T:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826028Protein Triosephosphate isomerase [51353] (21 species)
  7. 2826302Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 2826379Domain d1ag1t_: 1ag1 T: [28475]
    complexed with po4

Details for d1ag1t_

PDB Entry: 1ag1 (more details), 2.36 Å

PDB Description: monohydrogen phosphate binding to trypanosomal triosephosphate isomerase
PDB Compounds: (T:) triosephosphate isomerase

SCOPe Domain Sequences for d1ag1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag1t_ c.1.1.1 (T:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOPe Domain Coordinates for d1ag1t_:

Click to download the PDB-style file with coordinates for d1ag1t_.
(The format of our PDB-style files is described here.)

Timeline for d1ag1t_: