SCOP 1.63: Domain d4timb_: 4tim B:

Lineage for d4timb_ (4tim B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (15 species)

7. Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries)

8. Domain d4timb_: 4tim B: [28473]
   complexed with 2pg

Details for d4timb_

PDB Entry: 4tim, 2.4 Å

PDB Description: crystallographic and molecular modeling studies on trypanosomal triosephosphate isomerase: a critical assessment of the predicted and observed structures of the complex with 2-phosphoglycerate

SCOP Domain Sequences for d4timb_:

Sequence; same for both SEQRES and ATOM records:

>d4timb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d4timb_:

• d4timb_ first appeared (with stable ids) in SCOP 1.55
  
• d4timb_ appears in SCOP 1.61
  
• d4timb_ appears in SCOP 1.65
  
• d4timb_ appears in the current release, SCOPe 2.08