SCOP 1.75: Domain d4tima_: 4tim A:

Lineage for d4tima_ (4tim A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (18 species)

7. Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries)

8. Domain d4tima_: 4tim A: [28472]

Details for d4tima_

PDB Entry: 4tim, 2.4 Å

PDB Description: crystallographic and molecular modeling studies on trypanosomal triosephosphate isomerase: a critical assessment of the predicted and observed structures of the complex with 2-phosphoglycerate

PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d4tima_:

Sequence; same for both SEQRES and ATOM records:

>d4tima_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d4tima_:

• d4tima_ first appeared (with stable ids) in SCOP 1.55
  
• d4tima_ appears in SCOP 1.73
  
• d4tima_ appears in SCOPe 2.01
  
• d4tima_ appears in the current release, SCOPe 2.08