SCOPe 2.02: Domain d1tpdb_: 1tpd B:

Lineage for d1tpdb_ (1tpd B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)

6. Protein Triosephosphate isomerase [51353] (21 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)

8. Domain d1tpdb_: 1tpd B: [28471]

Details for d1tpdb_

PDB Entry: 1tpd, 2.1 Å

PDB Description: structures of the "open" and "closed" state of trypanosomal triosephosphate isomerase, as observed in a new crystal form: implications for the reaction mechanism

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1tpdb_:

Sequence; same for both SEQRES and ATOM records:

>d1tpdb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d1tpdb_:

• d1tpdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tpdb_ appears in SCOPe 2.01
  
• d1tpdb_ appears in SCOPe 2.03
  
• d1tpdb_ appears in the current release, SCOPe 2.08