Lineage for d1tpdb_ (1tpd B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18354Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 18355Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 18356Protein Triosephosphate isomerase [51353] (12 species)
  7. 18408Species Trypanosoma brucei [TaxId:5691] [51357] (16 PDB entries)
  8. 18415Domain d1tpdb_: 1tpd B: [28471]

Details for d1tpdb_

PDB Entry: 1tpd (more details), 2.1 Å

PDB Description: structures of the "open" and "closed" state of trypanosomal triosephosphate isomerase, as observed in a new crystal form: implications for the reaction mechanism

SCOP Domain Sequences for d1tpdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpdb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOP Domain Coordinates for d1tpdb_:

Click to download the PDB-style file with coordinates for d1tpdb_.
(The format of our PDB-style files is described here.)

Timeline for d1tpdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tpda_