Lineage for d1tpfa_ (1tpf A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143365Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1143366Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
  6. 1143367Protein Triosephosphate isomerase [51353] (21 species)
  7. 1143565Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 1143592Domain d1tpfa_: 1tpf A: [28467]
    complexed with dms

Details for d1tpfa_

PDB Entry: 1tpf (more details), 1.8 Å

PDB Description: comparison of the structures and the crystal contacts of trypanosomal triosephosphate isomerase in four different crystal forms
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d1tpfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpfa_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
efvdiikatq

SCOPe Domain Coordinates for d1tpfa_:

Click to download the PDB-style file with coordinates for d1tpfa_.
(The format of our PDB-style files is described here.)

Timeline for d1tpfa_: