SCOP 1.67: Domain d5tima_: 5tim A:

Lineage for d5tima_ (5tim A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (16 species)

7. Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries)

8. Domain d5tima_: 5tim A: [28465]

Details for d5tima_

PDB Entry: 5tim, 1.83 Å

PDB Description: refined 1.83 angstroms structure of trypanosomal triosephosphate isomerase, crystallized in the presence of 2.4 m-ammonium sulphate. a comparison with the structure of the trypanosomal triosephosphate isomerase-glycerol-3-phosphate complex

SCOP Domain Sequences for d5tima_:

Sequence; same for both SEQRES and ATOM records:

>d5tima_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d5tima_:

• d5tima_ first appeared (with stable ids) in SCOP 1.55
  
• d5tima_ appears in SCOP 1.65
  
• d5tima_ appears in SCOP 1.69
  
• d5tima_ appears in the current release, SCOPe 2.08