Lineage for d3ypib_ (3ypi B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 64294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 64295Protein Triosephosphate isomerase [51353] (13 species)
  7. 64310Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (5 PDB entries)
  8. 64320Domain d3ypib_: 3ypi B: [28464]

Details for d3ypib_

PDB Entry: 3ypi (more details), 2.8 Å

PDB Description: electrophilic catalysis in triosephosphase isomerase: the role of histidine-95

SCOP Domain Sequences for d3ypib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ypib_ c.1.1.1 (B:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae)}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilgqserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

SCOP Domain Coordinates for d3ypib_:

Click to download the PDB-style file with coordinates for d3ypib_.
(The format of our PDB-style files is described here.)

Timeline for d3ypib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ypia_