Lineage for d3ypia_ (3ypi A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1565957Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1565958Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1565959Protein Triosephosphate isomerase [51353] (20 species)
  7. 1565965Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (8 PDB entries)
  8. 1565980Domain d3ypia_: 3ypi A: [28463]
    complexed with pgh

Details for d3ypia_

PDB Entry: 3ypi (more details), 2.8 Å

PDB Description: electrophilic catalysis in triosephosphase isomerase: the role of histidine-95
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d3ypia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ypia_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilgqserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

SCOPe Domain Coordinates for d3ypia_:

Click to download the PDB-style file with coordinates for d3ypia_.
(The format of our PDB-style files is described here.)

Timeline for d3ypia_: